Pay in 4 interest-free payments of $53.12 Learn more
Ships within 48 hours · Estimated delivery Jul 27 - Aug 1
these cascades allow responses to complex stimuli such as growth factors and inflammatory cytokines
GISEVAAVSTTIWPSSAVYQSGSSLWAEEKATESPPTIALSTQASTTSSPKQNVGSEGQPPWVQEQDSTPEKSPGPEETN
Specificity: LHX1 polyclonal antibody detects endogenous levels of LHX1 protein
muscle contractility and protein synthesis
Uniprot: P56937
FYN (4B8) Monoclonal Antibody-MB3021 K4 System these cascades allow responses toFYN (4B8) Monoclonal Antibody Sizes: 50l, 100l Catalogue Numbers: MB3021 50, MB3021 100 Product: Liquid in PBS containing 50% glycerol, 0. 5% BSA and 0. 02% sodium azide, pH 7. 3. Swiss Prot: P06241 Host: Mouse Reactivity: Human, Monkey, Rat, Mouse, Applications: WB, ICC IF All Applications: WB: 1 500 1 1000 IF: 1 50 1 200 Background: Tyrosine protein kinase implicated in the control of cell growth. Plays a role in the regulation of intracellular
US$ 32750.00
US$ 67499.50
US$ 137499.50
US$ 15.00
US$ 12.50
US$ 25.31
US$ 13.31
US$ 27487.50
US$ 87500.00
US$ 5250.00
US$ 149999.50
US$ 7400.00
US$ 6950.00
US$ 87499.50